Extreme Series - Updated Everyday

Showing 21-102 of 102 messages
Extreme Series - Updated Everyday satishgsk 2/3/06 1:34 AM
Chail, India : Highest cricket ground on the Earth
Built in 1893 at an altitude of 2444 m above sea level by levelling the hilltop, this cricket ground is the worlds highest cricket ground. The ground was built by the Maharaja of Patiala, since no competitive cricket is being conducted here it does not appear in the Guiness records. Today, the ground is with Indian Military and is used by locals and the military.



---------------------------------------------------------------------------------------

Sultan Qaboos Grands Mosque in Bausher, Sultanate of Oman :Largest Hand-woven Carpet and Chandelier on the Earth
The Sultan Qaboos Grand Mosque is the main Mosque in the Sultanate of Oman. The Mosque is built from 300,000 tonnes of Indian sandstone. The main musalla (prayer hall) is square (external dimensions 74.4 x 74.4 metres) with a central dome rising to a height of fifty metres above the floor. The dome and the main minaret (90 metres) and four flanking minarets (45.5 metres) are the mosque’s chief visual features. The main musalla can hold over 6,500 worshippers, while the women’s musalla can accommodate 750 worshippers. The outer paved ground can hold 8,000 worshippers and there is additional space available in the interior courtyard and the passageways, making a total capacity of up to 20,000 worshippers.
A major feature of the design of the interior is the prayer carpet which covers the floor of the prayer hall. It contains, 1,700,000 knots, weighs 21 tonnes and took four years to produce, and brings together the classical Tabriz, Kashan and Isfahan design traditions. 28 colors in varying shades were used, the majority obtained from traditional vegetable dyes. It is the largest single piece carpet in the world.



The world's largest hand-woven carpet was produced by Iran Carpet Company (ICC) at the order of the Diwan of the Royal Court of Sultanate of Oman to cover the entire floor of the main praying hall of the Sultan Qaboos Grand Mosque (SQGM) in Muscat. The carpet measures over 70 × 60 meters, and covers the 4,343 square meter area of the praying hall, all in a single piece.


Image Courtesy: National Geographic, read more here


This crystal chandelier in the mosque is about 46 feet high (picture a four story building!). It is about 26 feet in diameter, and it comes to a weight of 8.5 tons which is close to 20,000 pounds! The chandelier is made of 600,000 Swarovski crystals, has gold plated metalwork. It contains staircases and platforms, necessary for maintenance, and has 1,200 dimmable halogen lamps triggered by more than 36 switching circuits. Given that the height of the ceiling in the main minaret is 90 metres, this huge chandelier is probably actually the most efficient way of lighting up the entire space!

The Mosque is built on a site occupying 416,000 square metres and the complex extends to cover an area of 40,000 square metres. The newly built Grand Mosque was inaugurated by Sultan of Oman on May 4, 2001.
---------------------------------------------------------------------------------------
Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwhenuakitanatahu , New Zealand : Longest Name of a place on the Earth
Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwhenuakitanatahu is the Maori name for a hill, 305 m high, in New Zealand.The name on the sign that marks this hill, which translates roughly as - The summit where Tamatea, the man with the big knees, the climber of mountains, the land-swallower who traveled about, played his nose flute to his loved one. At 85 letters, it is one of the longest place names in the world and one of the longest words used in English.



There are other places which compete for the longest name, a village in Wales boasts a village called Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch (58 letters), which in English means "Saint Mary's Church in the hollow of white hazel near a rapid whirlpool and the Church of Saint Tysilio near the red cave." The locals call it Llanfairpwll (pronounced thlan vire puth). Recently Bangkok is claiming that it has the longest name , Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit (163 letter), this claim is not yet officially recognized, who knows we might see this toppling the record for the longest name in the future but till then the city in New Zealand claims the top spot.
---------------------------------------------------------------------------------------
Tristan da Cunha : Remotest archipelago on the Earth
Tristan da Cunha is a group of remote volcanic islands in the south Atlantic Ocean, 2816 km from South Africa and 3360 km from South America, is an active volcanic island with rare wildlife & home to 268 British Citizens. Tristan da Cunha is the most remote archipelago in the world. It is a dependency of the British overseas territory of Saint Helena, 2173 km to the north. The territory consists of the main island, Tristan da Cunha (area: 98 km�, 38 sq mi ), as well as several uninhabited islands.
The islands were first sighted in 1506 by a Portuguese sailor, Trist�o da Cunha, although rough seas prevented a landing. He named the main island after himself, Ilha de Trist�o da Cunha, which was later anglicised to Tristan da Cunha Island.
The post office o nthis island is probably the remotest post office on the Earth !!

Copyright : pugsly2002(Travelpod)
---------------------------------------------------------------------------------------
Oymyakon, Russia : Coldest Inhabited place on the Earth
Oymyakon is a village in Oymyakonsky Ulus of the Sakha Republic, Russia, located along the Indigirka River.
Oymyakon is known as one of the candidates for the Northern Pole of Cold, because on January 26, 1926, a temperature of −71.2 �C (−96.2 �F) was recorded there (however, this fact is arguable because the temperature was not directly measured but obtained by extrapolation). This is the lowest recorded temperature for any permanently inhabited location on Earth. It is also the lowest temperature recorded in the Northern hemisphere, except for an unofficial lowest recorded temperature of −77.5 �C (−107.5 �F) at Mount Logan in the Yukon, Canada. Only Antarctica has recorded official lower temperatures with the lowest being −89.2 �C (−128.6 �F) near the Russian station of Vostok ( see my post below ).

Its name in the Sakha language means "non-freezing water"; due to the presence of a natural hot spring nearby. The ground there is permanently frozen.

Oxford geographer Nick Middleton's television series and accompanying book on people who live in extreme climates discusses his visit to this village, and describes ways in which inhabitants cope with the extreme cold. Middleton describes how Oymyakon lies between two mountain ranges, trapping cold air in between the entire year. Extreme cold temperatures are frequent annually in Oymyakon with temperatures going below −40 �C regularly, even in 2008 temperatures were observed well below this, −60.2 �C (−76.4 �F) was recorded on the 19th of January.
---------------------------------------------------------------------------------------
Shah Faisal Mosque, Islamabad, Pakistan : Largest Mosque on the Earth
The mosque has an area of 5,000 square meters and can hold about 300,000 worshipers, including those in the adjacent grounds. It is the largest mosque in the world, its relatively unusual design fuses contemporary lines with the more traditional look of an Arab Bedouin's tent, with its large triangular prayer hall and four minarets. However, unlike traditional mosque design, it lacks a dome, and like a tent, the weight of the main prayer hall in the center is supported by the four minarets. The minarets borrow their design from Turkish tradition and are thin pencil like. The interior of this prayer hall holds a very large chandelier and its walls are decorated with mosaics and calligraphy by the famous Pakistani artist Sadeqain. The mosaic pattern adorns the west wall, and has the 'Kalima' writtern in early kufic script, repeated in mirror image pattern.






Courtesy : Tribune India
The masjid's architecture is a departure from the long history of south Asian Muslim architecture, however in some ways it makes a bridge between Arabic, Turkish and Pakistani Muslim architectural traditions.

---------------------------------------------------------------------------------------------------

Nile, African continent : Longest River on the Earth
The Nile has two major tributaries, the White Nile and Blue Nile, the latter being the source of most of the Nile's water and fertile soil, but the former being the longer of the two. The White Nile rises in the Great Lakes region of central Africa, with the most distant source in southern Rwanda and flows north from there through Tanzania, Lake Victoria, Uganda and southern Sudan, while the Blue Nile starts at Lake Tana in Ethiopia flowing into Sudan from the southeast. The two rivers meet near the Sudanese capital Khartoum.
The northern section of the river flows almost entirely through desert, from Sudan into Egypt, a country whose civilization has depended on the river since ancient times. Most of the population of Egypt and all of its cities, with the exception of those near the coast, lie along those parts of the Nile valley north of Aswan; and nearly all the cultural and historical sites of Ancient Egypt are found along the banks of the river. The Nile ends in a large delta that empties into the Mediterranean Sea.
The word "Nile"(Arabic: 'nīl) comes from the Greek word Neilos (Νειλος), meaning river valley. In the ancient Egyptian language, the Nile is called iteru, meaning "great river", represented by the hieroglyphs shown here (literally itrw). In Coptic, the words piaro (Sahidic) or phiaro (Bohairic) meaning "the river" (lit. p(h).iar-o "the.canal-great") come from the same ancient name.

More discussion here

Photo Courtesy - www.richard-seaman.com
Some statistics
Length - 6,650 km (4,135 miles)
Drainage area - 2,870,000 sq km
Average Discharge - 5,100 cu meter / sec
Outflow - Mediterranean Sea
Countries in the drainage basin - Ethiopia, Eritrea, Sudan, Uganda, Tanzania, Kenya, Rwanda, Burundi, Egypt, Democratic Republic of the Congo

---------------------------------------------------------------------------------------------------

Dingo Fence , Australia : Longest Fence on the Earth
The Dingo Fence or Dog Fence is a pest-exclusion fence that was built in Australia during the 1880 - 85, to keep dingoes out of the relatively fertile south-east part of the continent and protect the sheep flocks of southern Queensland. It would eventually stretch 5,320 kilometers from Jimbour on the Darling Downs near Dalby through thousands of miles of arid country to the Eyre peninsula on the Great Australian Bight. It was only partly successful; Dingoes can still be found in parts of the southern states to this day, and although the fence helped reduce losses of sheep to predators, this was counterbalanced by increased pasture competition from rabbits and kangaros.

The 2500 km section of the fence in Queensland is also known as the Barrier Fence or Wild Dog Barrier Fence. It is administered by the Department of Natural Resources and Water. It joins the Border Fence in New South Wales, where it stretches for 584 km along Latitude 29. The fence passes the point where the three states of Queensland, New South Wales and South Australia meet (Cameron's corner), where there is a brass plate on the survey monument. It is known as the Dog Fence in South Australia, which is 2225 km long.


Image Courtesy - http://disordered.org

The fence is 6 feet (180 cm) high made of wire mesh, and extends for 1 foot (30 cm) underground. At first it was unsuccessfully used to try and keep out rabbits, with the fence built originally as a rabbit proof fence in 1884. It was more successful at keeping out pigs, kangaroos, emus and brumbies. In 1914 it was converted into a dog-proof fence

---------------------------------------------------------------------------------------------------
Burj Dubai ( Dubai Tower ), United Arab Emirates : Tallest Man made structure on the Earth
Burj Dubai is a skyscraper currently under construction in Dubai, United Arab Emirates, and is currently the tallest man-made structure on Earth. Construction began on September 21, 2004, and it is expected to be completed and ready for occupation in September 2009. As of 7 April 2008, Burj Dubai has reached a height of 629 m (2,064 ft), with 162 completed floors. Burj Dubai's final milestone will be to surpass the Warsaw radio mast in Konstantyn�w near Gabin, Poland (which stood at 646.4 m (2,121 ft) until it collapsed in 1991) to become the world's tallest structure of any type ever built.
It has already surpassed KVLY-TV mast, USA . Below are some of the other records this structure has
* Tallest structure: 629 m (2,064 ft) (previously KVLY-TV mast - 628.8 m (2,063 ft))
* Tallest freestanding structure: 629 m (2,064 ft) (previously CN Tower - 553.3 m (1,815 ft))
* Building with most floors: 164 (previously Sears Tower / World Trade Center - 110)[14]
* Highest Vertical concrete pumping (for a building): 601.0 m (1,972 ft) (previously Taipei 101 - 449.2 m (1,474 ft))
* Highest Vertical concrete pumping (for any construction): 601.0 m (1,972 ft) (previously Riva del Garda Hydroelectric Power Plant - 532 m (1,745 ft)[15])
Note: Additional records for tallest skyscraper are considered unofficial, as the CTBUH does not recognize records for buildings still under construction.


Image courtesy : burjdubaiskyscraper
The projected final height of Burj Dubai is officially being kept a secret due to competition from other buildings under construction or proposed; however, figures released by a contractor on the project have suggested a height of around 818 m (2,684 ft). Based on this height, the total number of habitable floors is expected to be around 162. However, the Burj Dubai's construction manager, has said only that the final height would be greater than 700 m (2,297 ft), and that it would be the world's tallest free-standing structure when completed

----------------------------------------------------------------------------------------------------
Chile : Strongest Earthquake on the Earth
Chile, 1960 May 22 19:11:14 UTC - Severe damage from shaking occurred in the Valdivia-Puerto Montt area. Most of the casualties and much of the damage was because of large tsunamis which caused damage along the coast of Chile from Lebu to Puerto Aisen and in many areas of the Pacific Ocean. Puerto Saavedra was completely destroyed by waves which reached heights of 11.5 m (38 ft) and carried remains of houses inland as much as 3 km (2 mi). Wave heights of 8 m (26 ft) caused much damage at Corral.

The Largest Earthquake in the World measured measured 9.5 on the Richter scale. Approximately 1,655 killed, 3,000 injured, 2,000,000 homeless, and $550 million damage in southern Chile; tsunami caused 61 deaths, $75 million damage in Hawaii; 138 deaths and $50 million damage in Japan; 32 dead and missing in the Philippines; and $500,000 damage to the west coast of the United States.
----------------------------------------------------------------------------------------------------
Colca Canyon, Peru : Deepest Canyon on the Earth
Twice as deep as the Grand Canyon in the USA. Unlike most of the Grand Canyon, portions of the Colca canyon are habitable, with pre-Colombian terraced fields still supporting agriculture and human life.
The river and valley were well-known to the Incas and their predecessors, and the Spaniards laid out townships along the valley, built churches along the way, notably the one at Coporaque, but for some reason, the towns never grew and the route faded from outside memory.
It wasn't until the early 1930's that the Colca valley was explored again, this time for the American Geographical Society. Colca Valley has been known by different names: The Lost Valley of the Incas, The Valley of Wonders, The Valley of Fire and The Territory of the Condor. It has even been called one of the Seven Natural Wonders of the World."
In the 1980's, with the Majes Hydroelectric Project, roads opened the Colca to the outside. One of the attractions to visitors is a glimpse into a way of life that has endured in isolation for centuries.


---------------------------------------------------------------------------------------------------

Mt. Washington Observatory : Windiest place on the Earth
From 1932 to 1937, the Mt Washington Observatory was operated in the Summit Stage Office then occupying this site. In a great storm April 12, 1934, the crew's instruments measured a wind velocity of 231 miles per hour, highest ever measured by an instrument



More here..

---------------------------------------------------------------------------------------------------

Millau Viaduct : Tallest bridge On The Earth
The Millau Viaduct (French: le Viaduc de Millau) is a cable-stayed road bridge that spans the valley of the River Tarn near Millau in southern France. Designed by French bridge engineer Michel Virlogeux in collaboration with British architect Norman Foster, it is the tallest vehicular bridge in the world, with one pier's summit at 343 meters (1,125 ft)�slightly higher than the Eiffel Tower and only 38 m (125 ft) shorter than the Empire State Building. It was formally opened on 14 December 2004 and opened to traffic on 16 December 2004.

Its construction took only three years, thanks to a pre-fabrication process in which 2,000 sections of the steel roadway were manufactured off-site, lifted into place, and aligned with the help of a GPS. The technique also allowed for the minimum disruption of the surrounding environment -- echoing the bridge's overall goal of relieving the river valley of traffic while connecting the highway systems of France and Spain. Its remarkably slender profile and the way its graceful span emphasizes the drama of the landscape prove that cutting-edge building technology need not be at odds with the natural landscape
---------------------------------------------------------------------------------------------------
Mt. Baker, Washington : Snowiest Place On The Earth
The highest seasonally cumulative precipitation of snow ever measured was on Mount Baker, Washington during the 1998�1999 season. Mount Baker received a staggering 29 m of snow, thus surpassing the previous record holder, Mount Rainier, Washington which during the 1971�1972 season received 28.5 m of snow.
Courtesy : Wikipedia

---------------------------------------------------------------------------------------------------

Great Barrier Reef , Australia : Largest natural feature on the Earth
The Great Barrier Reef is undisputed as one of the world�s most important natural assets. It is the largest natural feature on earth stretching more than 2,300km along the northeast coast of Australia from the northern tip of Queensland to just north of Bundaberg.

The Great Barrier Reef is one of the wonders of the natural world. It is World Heritage listed and is one of Australia's, and the world's, premier holiday destinations.

The Great Barrier Reef is home to more than 1500 species of fish
Photo courtesy of Voyages Australian Resorts
The area abounds with wildlife, including dugong and green turtles, varieties of dolphins and whales, more than 1500 species of fish, 4000 types of mollusc and more than 200 species of bird life. The Great Barrier Reef system consists of more than 3000 reefs which range in size from 1 hectare to over 10,000 hectares in area. The reef is scattered with beautiful islands and idyllic coral cays and covers more than 300,000 square kilometers.
---------------------------------------------------------------------------------------------------
Karl-Marx-Hof, Vienna, Austria : Longest residential building on the Earth
The Karl-Marx-Hof in Vienna, Austria holds the distinction of being the longest single residential building in the world at over one kilometer in length (1100m) and spanning four tram stops.
Karl-Marx-Hof was built between 1927 and 1930 by city planner Karl Ehn, a follower of Otto Wagner. It held 1,382 apartments (with a size of 30-60 m� each) and was called the Ringstra�e des Proletariats, or the Ring Street of the Proletariat. Only 18.5% of the 1,000 meters long, 156,000-m� large area was built up, with the rest of the area developed into play areas and gardens. Designed for a population of about 5000, the premises include many amenities, including laundromats, baths, kindergartens, a library, doctor offices, and business offices.

More Images can be seen HERE
---------------------------------------------------------------------------------------------------
Morecambe Bay : Largest Quicksand on the Earth
Morecambe Bay is a large bay in northwest England, nearly due east of the Isle of Man and just to the south of the Lake District National Park. It is the largest expanse of inter tidal mudflats and sand covering a total area of 310 km�.

The bay is also notorious for its quicksand and fast moving tides (it is said that the tide can come in "as fast as a horse can run"). There have been royally appointed local guides (holding the post of Queen's Guide to the Sands) for crossing the bay for centuries. This difficulty of crossing the bay added to the isolation of the land to its north which, due to the presence of the mountains of the Lake District, could only be reached by crossing these sands or by ferry, until the Furness Railway was built in 1867. This skirts the edge of the bay, crossing the various estuaries.
---------------------------------------------------------------------------------------------------
Coco de mer , Seychelles : Largest Seed on the Earth
The Coco de mer (Lodoicea maldivica), the sole member of the genus Lodoicea, is a palm endemic to the islands of Praslin and Curieuse in the Seychelles. It formerly also occurred on St Pierre, Chauve-Souris and Round Islands in the Seychelles group, but has become extinct on these islands.
It grows to 25-34 m tall. The leaves are fan-shaped, 7-10 m long and 4.5 m wide with a 4 m petiole. It is dioecious, with separate male and female plants. The male flowers are catkin-like, up to 1 m long. The mature fruit is 40-50 cm diameter and weighs 15-30 kg, and contains the largest seed in the plant kingdom. The fruit, which requires 6-7 years to mature and a further two years to germinate, is sometimes also referred to as the sea coconut, double coconut, coco fesse, or Seychelles nut.
The Seychelles nut was once believed to be a sea-bean or drift seed, a seed designed to be dispersed by the sea. However, it is now known that the viable nut is too heavy to float, and only rotted out nuts can be found on the sea surface; this explains why the trees are limited in range to just two islands. The sailors who first saw the nut floating in the sea imagined that it resembled a woman's disembodied buttocks. This fanciful association is reflected in one of the plant's archaic botanical names, Lodoicea callypige Comm. ex J. St.-Hil., in which callipyge is from Greek words meaning 'beautiful rump'. Other botanical names used in the past include Lodoicea sechellarum Labill. and Lodoicea sonneratii (Giseke) Baill.

Until the true source of nut was discovered in 1768, it was believed by many to grow on a mythical tree at the bottom of the sea; European nobles in the sixteenth century would often have the shells of these nuts cleaned and decorated with valuable jewels as collectibles for their private galleries. The coco de mer is now a rare protected species.
The name of the genus, Lodoicea, is derived from Lodoicus, the Latinised form of Louis, in honor of King Louis XV of France.
The species is grown as an ornamental tree in many areas in the tropics, and subsidiary populations have been established on Mah� and Silhouette Islands in the Seychelles to help conserve the species.
---------------------------------------------------------------------------------------------------
Jack Hills, Australia : Oldest piece of earth on th Earth
The Jack Hills are located in the Narryer Gneiss Terrane of the Yilgarn Craton, Western Australia, and comprise an 80 km long northeast-trending belt of folded and metamorphosed supracrustal rocks.This is the oldest piece of earth on the earth
Sedimentary siliciclastic rocks, interpreted as alluvial fan-delta deposits, are the major lithology. Minor mafic/ultramafic rocks and banded iron formation (BIF) are also found in the sequence. The overall sequence is generally considered to be a granulite gneiss, which has undergone multiple deformations and multiple metamorphic episodes. The protolith age of the Narryer Gneiss Terrane is variable, but generally considered to be in excess of 3.6 Ga (billion years).

Detrital zircons with ages >4000 Ma (billion years) have been found in these rocks and a 4,404 +/- 8 Myr zircon was found at Eranondoo Hill (Wilde et al., 2001), the oldest dated material on Earth. They were found within part of the 3.6-3.8 Ga (billion years) supracrustal sequence. These zircons are considered most likely to have been placed into these rocks by erosion of older material.

See this post by blt for more information
or
Here
----------------------------------------------------------------------------------------------------
Seoul, Korea : Most populated city on the Earth
Comparing the populations of the world's largest cities can be a confusing task, as the definition of a city for census consideration can vary from one nation to another. In the US, for example, a city's population includes only those who reside within its political limits. In other countries, a city's suburban and outlying rural area residents can also be included in its census figures.
This is based on information compiled by the Statistics Division Cities Population Database.
Seoul, South Korea with an approximate 10,321,449 is the most populated city on the earth. The capital of South Korea and once the ancient capital of the Baekje Kingdom (18 B.C. - 660 A.D.), Seoul literally means "capital" in Korean.
Metropolitan Seoul, with approximately 20.7 million people, is the world's fourth largest urban center, just behind Tokyo-Yokohama, Mexico City and Sao Paulo.
Founded in 1394 as the capital of the Kingdom of Choson, contemporary Seoul is the site of Caribbean Bay ( approximately 18km southeastward from city boundary ), the world's largest water park, which opened in 1996. It set a record for water park attendance, as more than 1.5 million people visited it within its first two years of inception


----------------------------------------------------------------------------------------------------
Rafflesia arnoldii, Indonesia : Largest Single Flower / parasite on the Earth

Several species of Rafflesia grow in the jungles of Southeast Asia, all of them threatened or endangered. Rafflesia arnoldii is the largest; its blossom attains a diameter of nearly a meter and can weigh up to 11 kg. Not only is it the world's largest flower, it is one of the most bizarre and improbable organisms on the planet. The largest flower in the world is actually a parasite!

It produces no leaves, stems or roots but lives as a parasite on the Tetrastigma vine, which grows only in primary (undisturbed) rainforest. Only the flower or bud can be seen; the rest of the plant exists only as filaments within its unfortunate host.
The Rafflesia is rare and fairly hard to locate. It is especially difficult to see in bloom; the buds take many months to develop and the blossom lasts for just a few days. How many of these strange plants still survive is unknown, but the last of them can be expected to vanish as the remaining primary forests of Borneo and Sumatra are burned
The rare Rafflesia, found only in the forests of Indonesia and Malaysia, grows from spores and takes about nine months to produce a flower - the mahkota, or inner cup, of large Rafflesia can hold several quarts of water.
The blossom is pollinated by flies attracted by its scent, which resembles that of carrion.Like the Amorphophallus, this flower stinks - the dead meat smell attracts flies. Because of its nine month gestation period, Rafflesia is linked with fertility traditions by tribal people living in the areas where it grows.

Rafflesia bud, one day before opening.

� Karl Lehmann
Bloom

� Karl Lehmann
Look at the size

� Karl Lehmann
Photo courtesy of Lost World Arts

----------------------------------------------------------------------------------------------------
Voronya Cave, Krubera, Georgia : Deepest Cave on the Earth
The Voronya Cave (aka Krubera-Voronia Cave) is the deepest known cave in the world. It is located in the Arabika Massif, West Caucasus, Abkhazia (a region of Georgia in the former Soviet Union). The height difference in the cave is 2,140 (� 9) meters.


See the multimedia content from National Geographic
HERE

----------------------------------------------------------------------------------------------------
Roe River, Montana : Shortest river on the Earth

The Roe River, which runs between the Missouri River and Giant Springs near Great Falls, Montana, is the shortest river in the world. Officially it is only 201 feet (61 meters) long. Lewis and Clark were the first white men to see Giant Springs and Roe River and it has been preserved today by the state of Montana for us to see and enjoy.

Oregon's D River also has a claim as the shortest river in the world. However in practice the length of both rivers can vary substantially, and to date the Roe River remains the shortest river officially.



(a special thanks to frank for locating this )
----------------------------------------------------------------------------------------------------
Vredefort Crater, South Africa : Largest impact crater on the Earth
Vredefort crater is the largest known impact crater on Earth. Located in the Free State Province of South Africa, the town of Vredefort is situated in the crater. The site is also referred to as Vredefort dome or Vredefort impact site. In 2005, the Vredefort Dome was added to the list of UNESCO World Heritage Sites for its scenic and scientific interest. Dating back 2,023 million years, it is the oldest astrobleme found on earth so far. With a radius of 190km, it is also the largest and the most deeply eroded. Vredefort Dome bears witness to the world�s greatest known single energy release event, which caused devastating global change, including, according to some scientists, major evolutionary changes. It provides critical evidence of the earth�s geological history and is crucial to our understanding of the evolution of the planet. Despite their importance to the planet�s history, geological activity on the earth�s surface has led to the disappearance of evidence from most impact sites and Vredefort is the only example on earth to provide a full geological profile of an astrobleme below the crater floor.

----------------------------------------------------------------------------------------------------
ScoresbySund Fjord, Greenland : Longest & Deepest Fjord on the Earth
Stretching for 350 km (217 miles) this fjord is the longest on the planet earth. It is located in East Greenland , relatively close to Iceland. This is also the deepest fjord at 1500 m deep

Fjord is a narrow inlet of the sea between cliffs or steep slopes. It is typically applied to a narrow inlet in a glacially over deepened valley, usually narrow and steep-sided, extending below sea level and filled with salt water.A fjord is formed when a glacier retreats, after carving its typical U-shaped valley, and the sea fills the resulting valley floor. This forms a narrow, steep sided inlet (sometimes as deep as 1300 m) connected to the sea.

For high resolution image overlay click HERE
----------------------------------------------------------------------------------------------------
Isaouane-n-Tifernine, Algeria : Highest Sand Dun...
Re: Extreme Series satishgsk 2/6/06 1:47 AM
Surprised none has challenged or updated this !!
_________________________
Satishgsk
Extreme Series - Updated satishgsk 2/6/06 2:16 AM
Updated with more extremes mountains and ice sheets
_________________________
Satishgsk
Extreme Series - Updated -Tallest Water fall satishgsk 2/7/06 2:26 AM
Extreme Series - Updated -Tallest Water fall
_________________________
Satishgsk
Extreme Series - Updated -Deepest Lake satishgsk 2/7/06 3:01 AM
Extreme Series - Updated -Deepest Lake
_________________________
Satishgsk
Re: Extreme Series - Updated firefysh 2/7/06 3:08 AM
An excellent piece of work, satishgsk.
Congratulations.

firefysh.
_________________________
A positive attitude may not solve your problems, but the number of people it will annoy makes it worth while.
Re: Extreme Series - Updated satishgsk 2/7/06 3:24 AM
Quote:

An excellent piece of work, satishgsk.
Congratulations.

firefysh.




Thanks Firefysh
_________________________
Satishgsk
Re: Extreme Series - Updated Jimmy_Lemon 2/7/06 4:14 AM
Thats a good read. I didn't know much of that nice work!
_________________________
Re: Extreme Series - Updated IanUK 2/7/06 5:53 AM
What a great post!

I must confess, I haven't looked at the placemarks as I know where most of these are, but I didn't know all the facts and info you provided. Thanks satishgsk !!!
Re: Extreme Series - Updated satishgsk 2/7/06 8:58 PM
Thanks Ian
_________________________
Satishgsk
Re: Extreme Series - Updated satishgsk 2/7/06 8:59 PM
Thanks Jimmy
I' ll try to post more in the future
_________________________
Satishgsk
Re: Extreme Series - Updated satishgsk 2/8/06 5:22 AM
Highest Vertical Drop : Trango towers added to the list
_________________________
Satishgsk
Re: Extreme Series - Updated satishgsk 2/9/06 1:49 AM
Current Updates :
- Bishop Rock, Isles of Scilly : Smallest Island on the Earth
- Lake Manitou : Largest lake within a freshwater island in the world
- Red Sea : Warmest & Saltiest sea on the Earth
- Indonesia : Biggest Archipelago on the Earth
- Atlantic Ocean : Saltiest Ocean on the Earth
- Arctic Ocean : Smallest & least Saltiest Ocean On the Earth
_________________________
Satishgsk
Re: Extreme Series - Updated IanUK 2/9/06 8:19 AM
Great update. It's nice to know that the UK has an "Extreme", extremes always seem to be in much more exotic places!
Re: Extreme Series - Updated satishgsk 2/10/06 1:43 AM
Todays Update to the EXTREME SERIES :

Isaouane-n-Tifernine, Algeria : Highest Sand Dunes on the Earth

The world's highest measured sand dunes are those in the Saharan sand sea of Isaouane-n-Tifernine in east-central Algeria. They have a wavelength of 5 km (3 miles) and attain a height of 465 m (1,526 ft).
_________________________
Satishgsk
Re: Extreme Series - Updated satishgsk 2/14/06 5:26 AM
Updated with - ScoresbySund Fjord, Greenland : Longest & Deepest Fjord on the Earth

Go to the PARENT POST for more
_________________________
Satishgsk
Re: Extreme Series - Updated satishgsk 2/21/06 2:36 AM
Updated :

Vredefort Crater, South Africa : Largest impact crater on the Earth
Vredefort crater is the largest known impact crater on Earth. Located in the Free State Province of South Africa, the town of Vredefort is situated in the crater. The site is also referred to as Vredefort dome or Vredefort impact site. In 2005, the Vredefort Dome was added to the list of UNESCO World Heritage Sites for its scenic and scientific interest. Dating back 2,023 million years, it is the oldest astrobleme found on earth so far. With a radius of 190km, it is also the largest and the most deeply eroded. Vredefort Dome bears witness to the world’s greatest known single energy release event, which caused devastating global change, including, according to some scientists, major evolutionary changes. It provides critical evidence of the earth’s geological history and is crucial to our understanding of the evolution of the planet. Despite their importance to the planet’s history, geological activity on the earth’s surface has led to the disappearance of evidence from most impact sites and Vredefort is the only example on earth to provide a full geological profile of an astrobleme below the crater floor.
_________________________
Satishgsk
Re: Extreme Series - Updated satishgsk 2/21/06 10:33 PM
Todays Update :

Roe River, Montana : Shortest river on the Earth
_________________________
Satishgsk
Re: Extreme Series - Updated satishgsk 2/27/06 4:15 AM
Update :-

Voronya Cave, Krubera, Georgia : Deepest Cave on the Earth
The Voronya Cave (aka Krubera-Voronia Cave) is the deepest known cave in the world. It is located in the Arabika Massif, West Caucasus, Abkhazia (a region of Georgia in the former Soviet Union). The height difference in the cave is 2,140 (± 9) metres.
_________________________
Satishgsk
Re: Extreme Series - Updated everyday satishgsk 2/28/06 12:19 AM
Update :
Rafflesia arnoldii, Indonesia : Largest Flower / parasite on the Earth
Full series here
_________________________
Satishgsk
Re: Extreme Series maksimfishing 2/28/06 7:33 AM
what about the most populated city?
Re: Extreme Series - Updated Everyday satishgsk 3/1/06 5:20 AM
Update :
Mount Thor, Canada : Greatest Vertical Drop on the Earth
_________________________
Satishgsk
Re: Extreme Series satishgsk 3/2/06 8:08 PM
Quote:

what about the most populated city?





Will post today
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday satishgsk 3/3/06 2:23 AM
Updates:

-Jack Hill : Oldest piece of earth on the Earth

-Seoul, Korea : Most populated city on the Earth
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday satishgsk 3/11/06 1:32 AM
Update :


Coco de mer , Seychelles : Largest Seed on the Earth
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday Braham_S_Aggarwal 3/11/06 8:32 AM
Nice work 'Satishgsk'. Keep it up.

----------------------------------------------------------

Also IMO you need not required to provide hotlinks to your previous posts of the same thread. Instead of it you may try posting your new extreme series related information in continuation of your old posts and it you are posting the placemarks as a collection then, you can also provide a link to the main post which contains the collection placemark.
_________________________
[color:"blue"] Worldwide Technologies [/color]
Re: Extreme Series - Updated Everyday satishgsk 3/14/06 3:04 AM
Updated :
Cheerapunji, India : Wettest place onthe Earth

Some more pictures on this place




_________________________
Satishgsk
Re: Extreme Series - Updated Everyday beno 3/14/06 1:26 PM
Just come across this, its very good

Beno
Re: Extreme Series - Updated Everyday satishgsk 3/29/06 11:19 PM
Quote:

Just come across this, its very good

Beno




Thanks Beno.. please do contribute if you know such extremes
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday satishgsk 3/29/06 11:22 PM
Point Noted my friend. Will follow your advice
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday satishgsk 4/12/06 1:38 AM
Updated : Morecambe Bay, UK : Largest Quicksand on the earth
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday satishgsk 4/17/06 5:45 AM
Update : Karl-Marx-Hof, Vienna, Autria : Longest residential building on the Earth
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday satishgsk 4/19/06 2:58 AM
Todays Update : Largest Natural Feature on the Earth
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday satishgsk 5/1/06 12:13 AM
Friends , Please help me put up some more extremes. ..Looking forward to your suggestions
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday awaddington 7/27/06 5:53 PM
Hi satishgsk ,

First I wanted to say thank you! Awesome post, and lots of fun to tour the gloabe with your kmz.

I wanted to share that I think you may have the wrong island for the "Largest lake on a fresh water island"

You show North Manitou Island in Michegan, but I think the lake you are referring to is on Manitoulin Island in Canada. I attached the kmz just in case.

Keep it up. I can't wait to see what else get added to the list!.

Cheers
Re: Extreme Series - Updated Everyday satishgsk 7/28/06 12:07 PM
I think you are right .. i was wrong in placing it near michigan. will change the placemark ..
Thank you awaddington
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday satishgsk 8/6/06 6:32 AM
Update : Mt. Baker, Washington : Snowiest Place On The Earth
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday DasEigentor 8/7/06 6:41 AM
Quote:

Friends , Please help me put up some more extremes. ..Looking forward to your suggestions




I love posts like these!

I hope that it is okay for me to suggest some for you! I guess I'll do this one by one and attach KML?

First, the highest wind ever recorded - Mt. Washington, New Hampshire, US.
Re: Extreme Series - Updated Everyday DasEigentor 8/7/06 6:45 AM
Second:

Hell's Canyon, border of Oregon and Idaho, US.

Deepest gorge in the US (in the world?) at 8000 feet deep. By contrast, the Grand Canyon is "only" 6000 feet deep.

(ps - after making yet another marker at Mt Washington I decided to use an exisiting marker for Hell's Canyon - hope that's okay.)
Re: Extreme Series - Updated Everyday DasEigentor 8/7/06 6:52 AM
And third for today:

Strongest Earthquake ever recorded:

1960, off the coast of Chile at magnitude 9.5!
Re: Extreme Series - Updated Everyday satishgsk 9/14/06 9:25 AM
Quote:



Not sure if this is right ..I also saw this

On May 3, 1999 as tornadoes ravaged Oklahoma scientist measured the highest recorded wind speed at about 7:00 p.m. near Moore, Oklahoma. A wind speed of 318 mph was recorded

but you may be right because tornado wind speed is not measured based on the damage caused, so you might be right .. will post it ..
thx
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday satishgsk 9/14/06 10:10 AM
I think - Colca Canyon, Peru is the deepest canyon on the Earth. check out my postHERE
_________________________
Satishgsk
Re: Extreme Series - Updated yipero 10/28/06 3:50 PM
Hello satishgsk !.... nice work on these fabolous places around the world !... I live in Chile and I notice some posts about Driest place on Earth "Atacama Desert" (that in fact it is !).. and huge earthquake measured at Valdivia City (9.5 Richter) :-)

Any way, I'm writing to complain a post about the Highest San Dune on earth... I really don't know how it was measured the Isaouane-n-Tifernine in Algeria.... also , What is a "dune" anyway ?... I'm doing this question because I know a sand dune formation at Nazca - Perú called "CERRO BLANCO" that has 2000 meters altitude above sea level and the "base" of the sand is at 1200 meters above sea level, so the vertical "height" of the dune could be the difference = 800 meters !!!... but that isn't the important thing :-) .. because the real matter is that you can acctually do a 1300 meters continue ride on a sandboard !!!

Here goes a link about Cerro Blanco where you can check how big is this "dune" ?...

http://www.mysteryperu.com/co_cerro_blanco.html

ALSO, you can see a VIDEO or a thrill sandboard ride of Cerro Blanco at:
http://www.alcanceaventura.com.br/images/sand-1.wmv

Cheerz
Yipero
Re: Extreme Series - Updated Everyday freeformfalldown 11/10/06 3:07 PM
On the subject of Mill Ends Park (World's Smallest Park), while you're in beautiful Portland, OR, also check out the world's largest city park, Forest Park. (See my "Wild in the City" post--updated today--for more details on this and other Portland parks). The world's largest park of any kind is Greenland National Park at over 80,000 square miles. I've been looking all over the place for the world's tallest structure: a radio mast in North Dakota.

This extremes thing is really cool, by the way. Keep up the good work!
Re: Extreme Series - Updated Everyday satishgsk 12/7/06 7:23 PM
Quote:

On the subject of Mill Ends Park (World's Smallest Park), while you're in beautiful Portland, OR, also check out the world's largest city park, Forest Park. (See my "Wild in the City" post--updated today--for more details on this and other Portland parks). The world's largest park of any kind is Greenland National Park at over 80,000 square miles. I've been looking all over the place for the world's tallest structure: a radio mast in North Dakota.

This extremes thing is really cool, by the way. Keep up the good work!





Thanks freeformfalldown - I will update this info ASAP
_________________________
Satishgsk
Lake Manitou - BAD INFO! MojoJojoFromIndy 1/6/07 5:10 PM
Dude, what are you smoking? The entire island of North Manitou isn't 10 miles long or 5 miles wide. Lake Manitou in the center can't be 10 by 30 miles! Update your info on Google Earth!

Also, just in case you are interested, North Manitou island is in Lake Michigan, not Lake Huron.
Re: Extreme Series - Updated Everyday ttraser 1/17/07 1:58 PM
I've been looking all over the place for the world's tallest structure: a radio mast in North Dakota.

This extremes thing is really cool, by the way. Keep up the good work!

The KVLY-TV mast (formerly the KTHI-TV mast) is a television transmitting tower in North Dakota, USA, used by Fargo station KVLY channel 11. At 2,063 ft (628.8 m), it is currently the world's tallest supported structure on land.

http://www.answers.com/topic/kvly-tv-mast

http://www.answers.com/topic/list-of-tallest-buildings-and-structures-in-the-world

Re: Extreme Series - Updated Everyday juicygeography 1/28/07 10:14 AM
Base jumping - the record is now Mera peak as described here: http://www.mounteverest.net/news.php?id=7951
Re: Extreme Series - Updated Everyday HerbyB 2/3/07 11:00 AM
Well regarding the most populated city, I tend to disagree.

Chongqing, China

Facts and figures of Chongqing
Provincial Capital Chongqing
Area in qkm 31815
Population (in 10000) 3130


That's a whooping 31.3 milion!!!
Re: Lake Manitou - BAD INFO! BruceWChristopher 2/4/07 2:46 PM
Lake Manitou is the correct lake but the island is called Manitoulin Island, which is in Lake Huron.
http://www.manitoulintourism.com/Maps%20&%20Mileage.htm
Re: Extreme Series - Updated Everyday satishgsk 2/10/07 10:00 PM
Thx Juicy geogrphy for the update. Series updated with Mear Peak info and placemark
_________________________
Satishgsk
Re: Lake Manitou - BAD INFO! satishgsk 2/11/07 5:29 AM
Thx for the update , I was wrong in my placement , corrected Lake Manitou .
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday TexanQuilter 3/12/07 10:47 PM
satishgsk -- This is a wonderful feature article... I'm amazed and appreciative. Thanks!
Re: Extreme Series - Updated Everyday Deanna1020 4/7/07 10:00 AM
That is not a picture of Cherrapunji - I'm from Cherra and it does not flood like that there as it is a hilly area
Largest Flower ? yudiweb 5/11/07 6:59 AM
I dont think so...
try this link bro:
http://www.cityofseattle.net/parks/_images/gardens/conservatory/CorpseFlower.jpg
Re: Largest Flower ? danescombe 5/19/07 4:40 PM
satishgsk --excellent post --very interesting
_________________________
Danescombe, whose real life name was Dave, joined the Google Earth Community Forum in November 2005 and quickly became a regular in the Fun & Games Forum. In August 2007, he became a moderator. Sadly, on March 4, 2009, he passed away following complications from surgery. He was 44 years old. Our entire Community mourns his loss.
Re: Extreme Series - Updated Everyday Moazzam7777me 6/5/07 8:17 AM
Great Work, keep it up
Re: Largest Flower ? satishgsk 6/16/07 11:59 PM
yudiweb , you are wrong and right !

Wrong, because the flower you cited (Titan arum) is not the largest flower , it is the largest inflorescence (cluster of many tiny flowers) .

Right, because the Titan arum has the largest unbranched inflorescence of all flowering plants and that is the update for today.

check out the upated extreme post HERE
_________________________
Satishgsk
Re: Largest Flower ? satishgsk 6/17/07 12:15 AM
Quote:

I dont think so...
try this link bro:
http://www.cityofseattle.net/parks/_images/gardens/conservatory/CorpseFlower.jpg




Yudiweb - You are wrong and correct in a sense

You are wrong because , the Rafflesia arnoldii is tthe largest flower and the flower you cited, Titan Arum, is the largest unbranched inflorescence of all flowering plants (cluster of many tiny flowers).

Check out the updated post here for the details
_________________________
Satishgsk
Re: Largest Flower ? satishgsk 6/17/07 12:18 AM
thx
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday satishgsk 6/17/07 12:21 AM
Thanks for pointing it out , will check that out
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday satishgsk 6/17/07 12:38 AM
Chongqing, China is not a city technically it is a province on its own. Correct me if i am wrong
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday Delta102 6/18/07 8:31 AM
What a great post
_________________________
Pets of Google Earth

Seasons of the Google Earth Community

NON POTESTIS LATERE
Re: Lake Manitou - BAD INFO! blaklite 6/23/07 9:26 PM
Looks like this POI is still in the wrong place on Google Earth. Please update. As others have stated, you're looking for Manitoulin Island, not Manitou Island and it's in Lake Huron, not Lake Michigan. Thanks.
Re: Lake Manitou - BAD INFO! satishgsk 6/24/07 6:25 AM
Blaklite : The Placemark is in the correct location. If you still think there is a problem , please send me the placemark.
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday rawl 6/25/07 8:57 PM
Shortest river ,,,,,,,,, its Oregon not Oregen, yes the D River it's only 120 ft depending on the tide. But the 2006 Guinness Book of World Records does not recognize any river as being the shortest. So we can say half of the time the D is the shortest and the other time the Roe is. But my real point was its Oregon, not Oregen
Re: Extreme Series - Updated Everyday satishgsk 7/2/07 11:13 PM
Rawl, You are correct. I have corrected the typo , also the Guiness part.

Thx for correcting the error.
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday Vidread 7/25/07 11:42 PM
Mate, i have something to say about that "Bishop Rock, Isles of Scilly : Smallest Island on the Earth " u post...

That is not the smallest island on earth... if my memery serves me right, the smellest island on earth is in New Zealand, around the area of Picton, it only have the size of a desk, and have only 1 smell tree on it.

But sadly i cant remember the name of the island, but if u go to picton and take the tour curiser of Marlborough Sounds, they will introduce u to the island on ur way around the sounds.
Re: Extreme Series - Updated Everyday satishgsk 7/27/07 11:05 AM
Vidread,
The smallest island in the world - according to the Guiness Book of Records - is Bishop Rock.

In 1861, the British government set out the parameters for classifying an island. It was decided that if it was inhabited, the size was immaterial . However, if it was uninhabited, it had to be "the summer's pasturage of at least one sheep" - which is about two acres .
By this classification , I think the island you are referring to and many such islands around the world will not qualify to be the smallest island on the Earth
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday Vidread 7/31/07 4:07 AM
okie doky, never know about that

I was been told that island is a regesited island with it's ow name on my last visite, think i'll go check it out with the tour if i got chance to visite again
Re: Extreme Series - Updated Everyday hotwellian 8/8/07 4:09 PM
Why should the British government definition be especially valid?
_________________________
Jezza, Boatman, Author and Administrator, Hotwells
Re: Extreme Series - Updated Everyday satishgsk 8/22/07 10:23 PM
Good question, not sure .

Any one knows if there is any regulation that governs islands ?
_________________________
Satishgsk
Re: Lake Manitou - BAD INFO! island_gord 10/18/07 9:34 AM
Quote:

Blaklite : The Placemark is in the correct location. If you still think there is a problem , please send me the placemark.




That Manitou Island would fit IN Lake Manitou on the ManitouLIN Island
Re: Extreme Series - Updated Everyday YoussefNaiem 11/20/07 7:59 AM
The Red Sea is a warm sea, no dought, but it cann't be the saltiest on earth since salts concentrations in the Dead Sea is so high that no living creature can live. Unfortunately, I don't have figures- of salts concentrations- in mind at the moment, but you can easily deduce the difference between the two seas which both are located in the Middle East.
Re: Extreme Series CARLY410 12/2/07 10:36 PM
I agree! i definitely think people should add to this list! its so interesting and I cant believe there arent more images. when was the most recent image taken???
Re: Lake Manitou - BAD INFO! JOEDWIGHT 12/28/07 6:32 AM
Manitoulin Island in Lake Huron has an interior "Lake Manitou", so this tag for the smaller lake in North Manitou Island (Lake Michigan) should be deleted!
Re: Extreme Series - Updated Everyday heomin 3/12/08 6:58 AM
You have mentioned, "contemporary Seoul is the site of Caribbean Bay", but it is not ture. The water park is located at about 18km southeastward from city boundary.

The park is located at 37 17 53.72N, 127 12 10.91E.
Re: Extreme Series - Updated Everyday Kilauea 4/13/08 2:09 AM
I've been looking at your photo of the world's tallest mountain, Mt. Everest, and it bears a striking resemblance to Makalu, a nearby peak. Could it be that you have got the wrong mountain represented? I enjoyed reading your page. Very educational and entertaining.

Namaste,
Kilauea
Re: Extreme Series - Updated Everyday satishgsk 4/15/08 8:55 PM
Thanks for your comments. The idea as you mentioned is to entertain and educate, there could some errors in my compilation. If people like you who have first hand information could help by providing right content / pictures this could be made better.

Looking forward to hear from you
_________________________
Satishgsk
Re: Extreme Series - Updated Everyday Hephaestos 5/1/08 4:29 PM
Since the Wikipedia photo used here is one of mine, I'm going to hate to see it go, but I thought I ought to mention that the KVLY mast is no longer the world's tallest structure. It was surpassed by the Burj Dubai earlier this year.
Re: Extreme Series - Updated kite_surfer 11/17/08 2:26 PM
GREAT find, yipero. here's another sand board video and here's the wiki link to prove you're right about the highest sand dune.

_________________________
"Do or do not. There is no try." (Yoda)
Google Earth Imagery Credits List
Re: Extreme Series - Updated Everyday satishgsk 7/3/09 3:49 AM
The Sultan Qaboos Grand Mosque is the main Mosque in the Sultanate of Oman. The Mosque is built from 300,000 tonnes of Indian sandstone. The main musalla (prayer hall) is square (external dimensions 74.4 x 74.4 metres) with a central dome rising to a height of fifty metres above the floor. The dome and the main minaret (90 metres) and four flanking minarets (45.5 metres) are the mosque’s chief visual features. The main musalla can hold over 6,500 worshippers, while the women’s musalla can accommodate 750 worshippers. The outer paved ground can hold 8,000 worshippers and there is additional space available in the interior courtyard and the passageways, making a total capacity of up to 20,000 worshippers.
A major feature of the design of the interior is the prayer carpet which covers the floor of the prayer hall. It contains, 1,700,000 knots, weighs 21 tonnes and took four years to produce, and brings together the classical Tabriz, Kashan and Isfahan design traditions. 28 colors in varying shades were used, the majority obtained from traditional vegetable dyes. It is the largest single piece carpet in the world.



The world's largest hand-woven carpet was produced by Iran Carpet Company (ICC) at the order of the Diwan of the Royal Court of Sultanate of Oman to cover the entire floor of the main praying hall of the Sultan Qaboos Grand Mosque (SQGM) in Muscat. The carpet measures over 70 × 60 meters, and covers the 4,343 square meter area of the praying hall, all in a single piece.


Image Courtesy: National Geographic, read more here


This crystal chandelier in the mosque is about 46 feet high (picture a four story building!). It is about 26 feet in diameter, and it comes to a weight of 8.5 tons which is close to 20,000 pounds! The chandelier is made of 600,000 Swarovski crystals, has gold plated metalwork. It contains staircases and platforms, necessary for maintenance, and has 1,200 dimmable halogen lamps triggered by more than 36 switching circuits. Given that the height of the ceiling in the main minaret is 90 metres, this huge chandelier is probably actually the most efficient way of lighting up the entire space!

The Mosque is built on a site occupying 416,000 square metres and the complex extends to cover an area of 40,000 square metres. The newly built Grand Mosque was inaugurated by Sultan of Oman on May 4, 2001.
_________________________
Satishgsk
More topics »